DPCstruct | MC20122
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 98 ± 7 aa |
| Standard deviation of domain lengths | 7.37 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10251 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3MM61 | 21-113 | EKAYRTCRNYFCIGIFFNPLLLLINSYQFCKRSKNIEIEHFKRRTKYFVMLSLIFGFFYIVLFGSWYCIYLIKRTSMGFNGDYISIS… |
| A0A3B3CI06 | 1-100 | MNLERLPNEEKLTLCRKYYLGGFAFLPFLWLVNVVWFFREAFIKPAYTEQLQIKTYVQRSAVGLLLWVAVLTTWITIFQHFRAQWGE… |
| A0A7R9EQV9 | 430-515 | None |
| A0A5S6QPK6 | 156-256 | None |
| A0A1Y1VFY3 | 1-92 | None |
| A0A817M5B6 | 2-95 | None |
| S9X161 | 1-98 | None |
| A0A6P8XBV2 | 1-96 | None |
| A0A4C1X0S5 | 100-204 | None |
| A0A6V7V0M8 | 3-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.