DPCstruct | MC20120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 116 ± 18 aa |
| Standard deviation of domain lengths | 18.19 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10135 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D7VHS5 | 16-92 | TDRHEAMWQAARDLEAGFIAEMLKTAGLAKTPSMFGGGSGEDQFAGFLIDEQAKLIVGQGGIGLAESIYQSLMKRDG |
| A0A6N9TUT3 | 6-109 | ITAPDAISLTEARSVDRTARGLRREDRRDPEALRAACRDFEAVFLRQLLKAMRKTVPKSGLLDGGFREELYRGLLDEEFARRMAEGG… |
| A0A354W2R4 | 1-141 | None |
| A0A539DSN5 | 1-107 | None |
| A0A1X7ANI4 | 1-104 | None |
| A0A1B3X652 | 3-141 | None |
| A0A381GPB6 | 100-237 | None |
| A0A1G3YGH7 | 35-167 | None |
| A0A1J4SZC7 | 7-137 | None |
| A0A2G4YLY3 | 8-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.