DPCstruct | MC20117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 68 ± 8 aa |
| Standard deviation of domain lengths | 8.08 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A564WHA2 | 192-259 | PMSPLKAIRLRCLDCSSGQPAEVRLCTAVTCPSWPFRMGRNPWRSEVSEGRREAARRNVATLNARTAP |
| R5ER49 | 3-67 | EKRLTPIKAIRAKCLDCCCGNSNEVKLCTCTGCALYPYREGHSPFIQKQEWTEERKAAQKARMAQ |
| A0A843FH00 | 19-85 | None |
| S7TRK0 | 16-80 | None |
| A0A353X8H0 | 2-78 | None |
| A0A437M750 | 25-101 | None |
| A0A419G405 | 5-70 | None |
| A0A6B2D518 | 27-100 | None |
| A0A126QMM9 | 7-73 | None |
| B0N8L9 | 16-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.