DPCstruct | MC20116
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 125 ± 8 aa |
| Standard deviation of domain lengths | 8.46 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 76.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5EQB7 | 16-131 | GSRLKKSKLVNPLYRVTDKDGKDIAYTAEQKDGVLTVTVDADFAVLTGKLSGIGTLKAQGVEKIVFVTKDATSAFRLADLLEKGAAG… |
| R5EH44 | 86-199 | IVGTVSASSEEPDKREPLYRVLNLDGSTLKHQAETADGVLTLTAKADGAILTGTLRALGYLQNQGIEKITFTDGTHTASIVLADLIA… |
| A0A2A6ZHR3 | 681-805 | None |
| A0A6L5TKZ2 | 213-324 | None |
| A0A3D4W0L7 | 164-286 | None |
| A0A1C6DP31 | 3-128 | None |
| A0A329THU6 | 74-209 | None |
| D4JZ66 | 380-500 | None |
| R5EZM8 | 36-172 | None |
| A0A174DIU5 | 104-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.