DPCstruct | MC20115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 231 ± 55 aa |
| Standard deviation of domain lengths | 54.55 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 86.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 16.77 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | CL0198- CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1R6T6 | 17-239 | ILPLDENGVAEVQIDDLGGRINLNDLVSAGGQVDPTTKDRLTHLLIALGITGVSVDALVDWIDPNDETISAYGAEDGQYLMAEPGFR… |
| A0A7S9DCB7 | 21-260 | STAGVELAAYQLSGAAPEVRPSHGSFTFRLANARVAVEYQSEAARINLNMAPRSVIAGLFVALGVESGAASQFADRIAAWRSAPKPN… |
| A0A812ZTL7 | 231-531 | None |
| A0A0N1JDF6 | 37-324 | None |
| A0A357SZQ2 | 5-186 | None |
| A0A182U2D8 | 165-409 | None |
| A0A182TIY4 | 344-580 | None |
| A0A426CHJ0 | 22-324 | None |
| A0A7C5N8Q8 | 2-175 | None |
| A0A2U3LIP8 | 9-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.