DPCstruct | MC20113
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 101 ± 15 aa |
| Standard deviation of domain lengths | 14.67 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7KYH3 | 12-100 | GKYAIQRKNVLKDHFPAAYQRMQMDGTLEEHLAYTQESVSNYVDICAERYKQTEEYKQAEAADPMEAMRLLNMTVLEAEEAAYRSWI… |
| A0A174FJP4 | 1-111 | MNVQYEQQGNYLIPCIRTKEQEEIHLGVLANRHRQYLKQNHKVRYYNLLTRERLYDYLDGVECQAEDLFEQTVKSLAEKEQVTEKLK… |
| A0A847P9N3 | 62-177 | None |
| A0A7X3MM76 | 91-204 | None |
| A0A6M4WEG5 | 8-106 | None |
| U2CUY8 | 1-91 | None |
| R9LMU3 | 10-90 | None |
| A0A415E520 | 38-129 | None |
| A8RX52 | 1-101 | None |
| E7GGA6 | 3-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.