DPCstruct | MC20111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 190 |
|---|---|
| Mean domain length (aa) | 112 ± 25 aa |
| Standard deviation of domain lengths | 25.33 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 87.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 24.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S5CZC9 | 2-61 | LAAQGGVCAICRTAPAAHVDHDHATGAVRALLCFNCNGGLGQFRDDPDVLQEAAAYVRFH |
| A0A257UEM4 | 19-120 | VCIDCEGKVNKGKMKDYYRGKEMFKKYGITIGDYYDIMKSQGGTCKICKAPSKIKGTRRLAIDHDHNTGKVRGLLCLQCNVMIGMSN… |
| A0A0N1GZV8 | 120-253 | None |
| A0A0F9NKW7 | 18-108 | None |
| A0A1E7KBE0 | 25-125 | None |
| W2CC61 | 1-123 | None |
| A0A0F9FDC4 | 13-103 | None |
| A0A848RV65 | 112-222 | None |
| A0A0F9NC29 | 2-130 | None |
| A0A2E8K221 | 30-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.