DPCstruct | MC20110
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 78 ± 9 aa |
| Standard deviation of domain lengths | 8.82 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 21.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10115 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S3PR36 | 20-92 | SEPEDYKGFVLRAAPFDAEGQFQTAGSISKEVGGETKTHEFIRADRHASYEEAVSFALMKARQIVDEQGDRVF |
| A0A1F5V0K2 | 2-70 | DKNRISYNGYIIEANTHQLETKKWTLDITIYKNYGNKVVAKPFYSNNTFENKEDAINNCYIFGSNIIDG |
| A0A4V6P5C5 | 1-70 | None |
| A0A535BFL0 | 3-71 | None |
| A0A534S6P5 | 1-70 | None |
| A0A244DPY4 | 1-66 | None |
| A0A2V7BRE9 | 2-95 | None |
| A0A561XIN0 | 20-86 | None |
| A0A1W1I0M8 | 3-81 | None |
| H4F0E5 | 4-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.