DPCstruct | MC20105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 148 ± 17 aa |
| Standard deviation of domain lengths | 17.24 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A094B0V6 | 436-613 | MSKGPRLCPDERLRSRLYEPLVLLHVLDRNGEQRISRCPSEDLVAPQLQQLRELRRDFLDKLAYICDHVKGGDTVTAIALEAHPSGI… |
| A0A1V6PI53 | 15-156 | KRVGRPRLDPYQRLLGRFYEQLFLLNALGQTRGNHKTSSFELDAARARRRRFLQNLCFVCDFRKGGSTCTAIGLEELDTRYNFFVAS… |
| A0A4V3HW37 | 266-404 | None |
| A0A175W4P0 | 177-303 | None |
| A0A420MIK2 | 6-143 | None |
| A0A2H4SIU9 | 201-362 | None |
| A0A2H2Z9A1 | 16-185 | None |
| A0A4Q4YTJ6 | 1-152 | None |
| A0A094AYR8 | 5-157 | None |
| A0A0A2V643 | 3-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.