DPCstruct | MC20103
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 158 ± 5 aa |
| Standard deviation of domain lengths | 5.05 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 86.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C8IGR1 | 215-378 | APALTPDLAAQLARVAPSHDGTLQYFPCQVTLRSGEVLPRVCFAEQSRLRAHWGDDPRGNTVDPREVVAIEESPYRMPQRFADELYE… |
| A0A2V6H5A8 | 1-156 | MMEYFPCMVLLANGEQHDCVYIAESNSYIRFWGVWPDEDPGKRAIRIEDVAQIQPSPFRLPFKFAREMYVVGESGMGYCIFTLHFAD… |
| A0A517VP73 | 66-223 | None |
| A0A4Q3LH57 | 1-150 | None |
| A0A402BQX7 | 98-260 | None |
| A0A7X8NE29 | 88-240 | None |
| F5LK46 | 93-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.