DPCstruct | MC20100
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 213 ± 36 aa |
| Standard deviation of domain lengths | 35.79 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177QNH7 | 4-165 | LRVIGPEGSKATFFPDSFREQELPTPAEVSVRPGYIYHFRLANLPQGKDAVIYPTVEVIGALQLPPPCCARNYPLPIVISEDDVDRV… |
| A0A3A0DGH6 | 25-200 | KGHCGDQPDAQIYFESPEAAVVAWGGETSDERTTLPGRQNFPLGASYDLHVSKLPGLKAQRASMRLTLVASPGPEADRYLEHNPIPV… |
| A0A517N7P4 | 56-322 | None |
| A0A357XVI1 | 131-332 | None |
| A0A5C5YS81 | 14-210 | None |
| A0A3E0PGJ9 | 1-191 | None |
| A0A517QGR9 | 36-223 | None |
| A0A7Y5W4G3 | 35-231 | None |
| A0A518E2X2 | 55-281 | None |
| A0A812P7J0 | 420-677 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.