DPCstruct | MC2010
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 217 ± 20 aa |
| Standard deviation of domain lengths | 19.80 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 47.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9IVB9 | 326-543 | LDGPRPPQKDILAIRAYILLFLKQLIMIGNGVKDDELQSILNYLTTMHEDENLHDVLQMLISLISEHPASMVPAFDVKQGVRSIFKL… |
| A0A0M3KHH5 | 2-185 | ALTTRLLAERPAVMVPAFDRNKGLAVVFKLLNSTNELIRVPALKIFGFFLCRSTLKRKNDSVGNLNLFTLLTDRLLLNASYLSLATY… |
| A0A0V0XHR6 | 670-870 | None |
| H0XPV2 | 570-801 | None |
| A0A3Q0IZU0 | 1-253 | None |
| A0A6A5FRB7 | 113-332 | None |
| A0A817QFF4 | 42-271 | None |
| W2TJQ2 | 93-327 | None |
| A0A336M010 | 74-295 | None |
| A0A336KVB2 | 3-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.