DPCstruct | MC201
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 278 ± 31 aa |
| Standard deviation of domain lengths | 30.98 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 20.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E7D448 | 104-339 | RSAEVHVVGFYEGHYPTGEGHSGNSHPTGKARVRVTRSETPAVLVLTSYEPIEWKVECEEGANLVQILLSGNHPQSVVGQPEGTPIA… |
| A0A5D3KPR7 | 155-404 | AADALIIAYGTTWGEIYSSVSTVGLGRETRASRVVVEPGSRPIYAILGSSGPLIWKIEGDTTRIDRVILVTPPGSESAFPSAVVGVP… |
| A0A844SH25 | 10-262 | None |
| A0A4T3F667 | 294-578 | None |
| A0A7Y4YP47 | 856-1179 | None |
| A0A1Q6UB85 | 528-798 | None |
| A0A2A5GWN6 | 36-325 | None |
| A0A161J847 | 1-233 | None |
| A0A1Y3D010 | 47-330 | None |
| A0A4S1WHT2 | 51-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.