DPCstruct | MC20099
Metacluster Properties and Pfam Annotations
| Number of structural domains | 94 |
|---|---|
| Mean domain length (aa) | 160 ± 35 aa |
| Standard deviation of domain lengths | 35.12 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 81.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 23.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15607 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D8ZT87 | 44-200 | QRFDRTISYMHMEMVTNINEVGNIRLLNRLGRFSQGSKAAALAAWALKVRSGGDWDHKPKLSTMLEFDGNEPPTFPIPGDDEHEYNY… |
| A0A3A0DEX1 | 14-167 | WFVGQLLANGKIANGKRPGIGSALIGLGGILVDKGLTLRWFKNQVQNGGPWDFKNNALKGDKTAGILFAGTHYRYDMPGNFHYGYVG… |
| A0A3M1FPR2 | 151-352 | None |
| A0A1E7IAP0 | 7-84 | None |
| A0A0N0J7X4 | 78-266 | None |
| A0A1I7FCM6 | 109-269 | None |
| D9TS79 | 133-275 | None |
| A0A6G3VHD7 | 19-187 | None |
| A0A356Z8Q4 | 26-191 | None |
| A0A356FY74 | 23-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.