DPCstruct | MC20097
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 88 ± 8 aa |
| Standard deviation of domain lengths | 7.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 55.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H0A7D3 | 87-186 | DPKLSSRAVREYLEALDEEALAEALPKKISLTDPQSRWTAAPGGPAFFAYSTNYLIDTEHGVIMDVEATPAHRTAEVDSTRTMVERV… |
| B9KUG5 | 2-90 | REYLEVLDDAAFGAAIDTQPKFMSYADPAAQWTGAKKGPAHFAYADNSVIDTDHAVIVDVEAIRAIRRVEVGSVRTMIERTKERFDP… |
| A0A1I4UMN8 | 24-118 | None |
| A0A258FAZ2 | 1-72 | None |
| A0A533HYB5 | 58-140 | None |
| A4EPT1 | 55-131 | None |
| A0A3M2VCI4 | 101-183 | None |
| A0A560IVF7 | 21-108 | None |
| A0A173KYZ4 | 50-137 | None |
| A0A543MYZ1 | 123-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.