DPCstruct | MC20096
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 94 ± 13 aa |
| Standard deviation of domain lengths | 13.35 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0663 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5C5V4 | 25-104 | TALVKLMEDAGCEKANVVAHILGGGAPEGERSPTLGERNVAAAREALSRRQITILAEDTGGPLGRKIVFDTGTGELAVLK |
| B9KQA7 | 18-94 | IEAKIFGGAMMTPQLGAIGQANAAFARRYLSDEGILCTAQSLGGNRARRIRFWPKTGRVQQMFLGSEDVLPTEQPQL |
| A0A4Z0BCH4 | 140-223 | None |
| A0A1W1X8U8 | 99-186 | None |
| A0A7V1RFB8 | 55-164 | None |
| A0A110B459 | 24-135 | None |
| A0A7X8F0Z7 | 80-168 | None |
| K1YU57 | 4-84 | None |
| A0A272EUK6 | 923-1026 | None |
| A0A3T0VWL5 | 50-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.