DPCstruct | MC20093
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 123 ± 30 aa |
| Standard deviation of domain lengths | 30.14 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 80.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A8P3X9 | 2-73 | REVLFLCEVINTHAEGEPPNRIIRFGPLFYIYAHYSDKLVGMLIRARKYKLVDFEGEMLYQRQDDDKIIRLL |
| A0A814KR04 | 12-123 | LVQCQHEFQEKLHEMQTPPPPLIRSANNQHETEYNVMDEITRVHRLIRAHGEQGDFGMQMKFGNLIPIYGNNQVDKLSEVLANARKN… |
| A0A813ST42 | 5-141 | None |
| T1KS56 | 13-133 | None |
| O62234 | 9-145 | None |
| A0A7R9NWH6 | 64-235 | None |
| A0A5B7F7D7 | 1-140 | None |
| A0A482X8B0 | 31-194 | None |
| A0A7S4EGZ9 | 133-248 | None |
| A0A044VB34 | 35-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.