DPCstruct | MC20091
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 103 ± 15 aa |
| Standard deviation of domain lengths | 14.88 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 59.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818N0D2 | 2-102 | EVLWNNRCYYLDGSGGVCESGYALGTNAALTCIASQFAGKNYRNATSSNCCIWTADTYECYGMNSNCNSAGPFSQGPILNGANCLNA… |
| A0A814GP77 | 22-123 | QSYEVSWNNHCYYLDGSGGNCTAGYSRATNAVLNCISSQFVGKTYRSTISNNCCIWTADTYECYRLTSNCNSAGPFKAGPNSVGCTN… |
| A0A819S070 | 653-745 | None |
| A0A815S2M8 | 95-213 | None |
| A0A815SDV2 | 123-222 | None |
| A0A816PT56 | 180-294 | None |
| A0A819VK52 | 170-281 | None |
| A0A817XF12 | 3-72 | None |
| A0A819CY45 | 1-79 | None |
| A0A814SWD0 | 41-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.