DPCstruct | MC20086
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 115 ± 11 aa |
| Standard deviation of domain lengths | 11.07 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H1ZEC4 | 36-153 | IGNPAAGKIRSHDSEGLPFLIDPPVHEPSPDDIERDLTAVLNRHLDAVAGQRRYDSRFTCSLRAGFPGPFQEEGRVFAAWMDACNMA… |
| A0A679JN50 | 21-136 | DPENADYLAFVEWAADNEPALPAGPTLEQRAAVLLAGVDAHLNAAARAKGYDSILSASVRAALPESPFHADGVAFGTWMDQVYAACY… |
| A0A256FC84 | 37-134 | None |
| A0A6L6YGA1 | 32-152 | None |
| A0A0G9HGX7 | 3-129 | None |
| A0A6I4E785 | 78-195 | None |
| A0A7X7AGR5 | 42-174 | None |
| A6F0I4 | 5-109 | None |
| A0A849TG08 | 15-126 | None |
| R5ELP3 | 32-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.