DPCstruct | MC20082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 246 ± 34 aa |
| Standard deviation of domain lengths | 34.13 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.78 |
| Pfam Score | 92.40 |
| Assigned Pfam label(s) | CL0036- CL0546- PF12972 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A644YTX0 | 2-174 | DVVRQSLADRGRIVYNRAVADFKSFDKKAFKKHSEEFLHLLLLQDKLLGTRSEFRVGTWIEKARNLGNNDEEKNLYEWNARVQITTW… |
| A0A2N2PF17 | 503-738 | RKAWDILYESRYNQTNLIDNARLSFAPQLMDSFEMDPAVAEAWGLMIDGAPELKDNPAYQFDLVNLGRETLGNFAPYYVLAVKKAVE… |
| A0A803LC15 | 400-675 | None |
| A0A7R9Q6U0 | 77-299 | None |
| C1E893 | 733-975 | None |
| A0A3B4UW14 | 235-436 | None |
| A0A6J0PLB7 | 355-632 | None |
| A0A7M5TUX8 | 87-333 | None |
| F4Q7Q8 | 272-515 | None |
| A0A4S4DES6 | 275-538 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.