DPCstruct | MC20081
Metacluster Properties and Pfam Annotations
| Number of structural domains | 121 |
|---|---|
| Mean domain length (aa) | 197 ± 45 aa |
| Standard deviation of domain lengths | 44.77 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 84.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.23 |
| Pfam Score | 98.96 |
| Assigned Pfam label(s) | CL0179- CL0649 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843GX96 | 1-129 | ERVAMGMDKYIEGDIVIDKEERIVRDKTNEEFQEMVSSFEINQTCPLYGTKVPFAGGEVGKMEEAILDSYGLTKADFEVPKMPRLGS… |
| A0A1V4TY91 | 17-190 | ICVLPTNLQMMFVHAYQSYLFNLMLSERMRRGMPLNAPSVGDIVLPADRDGNPDHDKQVPVTRTNIDLVERQVRDRRAFISATLFGS… |
| A0A2E9A3P2 | 327-494 | None |
| A0A7S2N0L4 | 18-180 | None |
| A0A7S4NX46 | 174-415 | None |
| A0A7Y4YGD3 | 3-129 | None |
| A0A538Q4U6 | 169-346 | None |
| A0A7C0ZH78 | 54-221 | None |
| A0A7S3ZR11 | 207-414 | None |
| A0A7S3ZR76 | 43-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.