DPCstruct | MC2008
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 112 ± 13 aa |
| Standard deviation of domain lengths | 12.78 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08608 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1XQM9 | 311-417 | LTMEHVPWHEEVINFATAIAENSDLDYELVCEHEHSCLVLLARRSKFFREGKWHTWIDYPRYFELFRRYEATGEEFGASDYMAETPA… |
| A0A7S4E8N7 | 28-138 | NLTHCLISTQVEAFCKELAARIAKDHPSCPTYEVACAHKHSVSVLLARCDQLKAPDGTWDTWIDYDRFHALAASGEPFTVEDYKAPC… |
| A0A7J6LW53 | 487-597 | None |
| A0A179HZB7 | 959-1084 | None |
| A0A2C9JZ68 | 118-228 | None |
| A0A7S1UTG3 | 9-126 | None |
| A0A7R9PW48 | 495-623 | None |
| A0A0C2ICF2 | 262-370 | None |
| A0A7S2USQ9 | 109-227 | None |
| A0A2K6F240 | 491-612 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.