DPCstruct | MC20078
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 129 ± 9 aa |
| Standard deviation of domain lengths | 8.52 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K0E090 | 6-133 | QLSTIAWLLLHFLDCSYQTTYGEFFPSVPGELTGQSFPVTLKTNASSDLVIVKCPGSHYRHTKTTDDFSLTKNQHQLDLSHHTDDKV… |
| A0A0K0ENI7 | 1-154 | MFLHFQLATIAWLLLHFLDCSYQTTYGNFFPSVPGELTGQSFPVTLKANASSDLVIAKCPGSSYRHIKTTDHFSLNEKIRDMDVFYY… |
| A0A0N4ZZR2 | 4-139 | None |
| A0A0N4ZFT2 | 2-127 | None |
| A0A0N5BI75 | 6-129 | None |
| A0A0N5BFX0 | 3-129 | None |
| A0A0K0G0C2 | 1-114 | None |
| A0A0K0FP52 | 6-130 | None |
| A0A0N5B9V9 | 4-132 | None |
| A0A0K0FM49 | 21-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.