DPCstruct | MC20077
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 99 ± 15 aa |
| Standard deviation of domain lengths | 14.98 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15795 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D7FIX6 | 5-79 | RKTFIDPPVLRKPLAFVLLVINVFVPGLGTVIAGFLTCKLKSIFTGILQLVTTSLVVGWVWSVMWGWELWTLARR |
| A0A0K0ENC7 | 29-121 | RHGVLRKAIPCMTMPNAIFCCISNFIIPGLGTLLSAFAIPTGSNYESDQTMIWAFMTNILTAFLQLITAPLIVGFIWSMIWGIIFIQ… |
| A0A7I8VSI4 | 119-222 | None |
| A0A814BRN7 | 588-686 | None |
| E2B3U4 | 154-254 | None |
| A0A195CP38 | 1006-1127 | None |
| A0A6J3C5S1 | 1-91 | None |
| A0A2A6CTB7 | 85-176 | None |
| A0A077ZXW3 | 5-87 | None |
| P16537 | 94-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.