DPCstruct | MC20071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 131 ± 31 aa |
| Standard deviation of domain lengths | 30.83 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 77.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M9RN43 | 1-84 | MVKAIARGFRWRKLLETGVHTTIEDIAAAEKITASYVSRVLRLTLLSPSIVEAILDGRQGPEITLATLMNPFPVEWEKQKSTFF |
| A0A0P1EW29 | 14-126 | TIPFRVAKRGGRKEVQLPPGTHNRSPDYTLIKAVARAYRWRQILEDGDMGTIAELAEFEKISPSYLTRVMRLTLLAPDIIEAILDGN… |
| A0A4P1K8N7 | 76-226 | None |
| A0A2G2M0F3 | 225-366 | None |
| Q4EAA6 | 232-355 | None |
| A0A1Y5TZ93 | 29-227 | None |
| A0A1G6EQ27 | 48-156 | None |
| A0A1H8IUT6 | 14-149 | None |
| A0A2A4FVT4 | 1-107 | None |
| A0A2M6VE25 | 21-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.