DPCstruct | MC20065
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 160 ± 29 aa |
| Standard deviation of domain lengths | 28.69 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 20.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19503 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F5T8C7 | 2-148 | RLYLSTLGKNPIVFEIEIDKKYCAKTYIEDYKELILYLEIKYDPNHTFKPVDLFEALNNKIPKKFQRKPNCSEVVSVASKRRRVEEA… |
| A0A1L8SZ86 | 17-188 | GEKKQRFTIEYNGVRAHVLFLADIEPFLLIFGIQGTNEYFELEMTRDFEVNSFFVKELYRKLIEIFNIQYDPDHKFTPNDFLSFVNN… |
| A0A3D5LE02 | 71-221 | None |
| A0A824A312 | 1-138 | None |
| A0A151G5I8 | 7-208 | None |
| A0A0E3XL90 | 34-189 | None |
| A0A2A7DBJ5 | 23-220 | None |
| A0A522RNY5 | 8-213 | None |
| A0A243G8N3 | 54-200 | None |
| A0A344UUR1 | 111-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.