DPCstruct | MC20061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 152 ± 8 aa |
| Standard deviation of domain lengths | 8.00 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F7SBR7 | 1-164 | MPLRWIFPGYAQIRSFLYKSGRHARLPYSVLRNIAAKATLNAGVFALEGTAPHWAAMQAWQRVLLRRGKPFTADQMALSLSIYEDRL… |
| A0A537W3U2 | 51-191 | WNLAWKCYREAFGWRVADRLGRNPMVNCGVFALHRDAPHWQAWARIMTGVLQRTRFFYVEQIALNYAIFADNLPANFLPAYCNWMPG… |
| A0A142XDP9 | 145-306 | None |
| A0A418VYZ1 | 63-209 | None |
| A0A370K9H4 | 1-157 | None |
| A0A2E7DEU0 | 321-459 | None |
| A0A7X6CGJ2 | 145-292 | None |
| F5UDC8 | 136-290 | None |
| Q2JVM4 | 139-286 | None |
| A0A6M0GA78 | 161-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.