DPCstruct | MC20060
Metacluster Properties and Pfam Annotations
| Number of structural domains | 103 |
|---|---|
| Mean domain length (aa) | 130 ± 21 aa |
| Standard deviation of domain lengths | 20.65 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12637 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M3XNV0 | 3-135 | PPRYPLPDTRQSLTHSFDICLDTGEKKSFYVTCGMYNDGRLGEIFIEHGMEGSFLGRSLDNLAMAMSIGLQYGVPLEVYTAKLRGQR… |
| F7S6C6 | 156-292 | SLPAPRAASAGRGKLPARRGGYTQKVSVGGHRLFLRTGEYPDGRLGEIMISLPKDSATLRGMAEAFAGAVSIGLQHGVPLDEFVDEF… |
| A0A3B9ZME5 | 3-117 | None |
| A0A3D5DJT3 | 4-121 | None |
| A0A0U1PB78 | 25-175 | None |
| A0A7C1NGW0 | 122-235 | None |
| A0A6L7YMU8 | 35-169 | None |
| A0A4R4ZUQ9 | 1-112 | None |
| A0A662U160 | 8-141 | None |
| A0A348PFS3 | 42-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.