DPCstruct | MC20059
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 171 ± 24 aa |
| Standard deviation of domain lengths | 23.75 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2SM62 | 55-221 | SDLVTKIMNGKKYQFDAFVHYPYDGGIKDEQTGYQLFFHAHREDEYGHFHTFAKDNDGSLIHLVLISMNDKGELIGLATVNRWVTGD… |
| F7S3R1 | 2-149 | SGWRFFYHAHAVRERLRAEHGHFHIFTPGPAGGMGFTHLIGISVDVQGLPIRLFTTNRWVTDEAWQPAAAIGRRVLRPRLAGASPGD… |
| A0A1G0V4H0 | 1-116 | None |
| A0A238D4T2 | 29-241 | None |
| F8L7Q6 | 85-268 | None |
| F7XFW5 | 102-271 | None |
| A0A848QCH8 | 11-180 | None |
| A0A259SCU2 | 2-148 | None |
| E6PPS9 | 1-166 | None |
| A0A537QYD3 | 26-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.