DPCstruct | MC20058
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 276 ± 59 aa |
| Standard deviation of domain lengths | 58.98 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 74.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06428 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821Y308 | 45-200 | SDMSTTQNSIDNILSREFTCWEEKPSIERDSSVFMYRIYNEDILPCLTFPNADLSSKVLAAIETNDVAMEACHSKGNMKTCSLMGEL… |
| A0A0N4TXI6 | 12-263 | QIVQLEKELRHSIAEKEAKYTRLSELQNHIDSEVQELTEKLVQVDMLMAEVEALKVIVMSPVFSSSSQVTHIPQRTGLALRFLGSTR… |
| A0A5S6Q8Y1 | 273-580 | None |
| A0A1I8IGB6 | 538-873 | None |
| A0A4W6DY21 | 40-295 | None |
| A0A1Y1WDP4 | 21-317 | None |
| A0A0B7NMI0 | 106-412 | None |
| A0A369S3P3 | 46-304 | None |
| G0NZ26 | 286-599 | None |
| A0A4V1IQ75 | 98-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.