DPCstruct | MC20052
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 164 ± 18 aa |
| Standard deviation of domain lengths | 18.04 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 29.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0018 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A210QUQ3 | 1-184 | MLQRDTCSPTPSTYTLPSTSTPPTKLPPPHAQDEETLVAATLLALETGDLTPLIKEELKYTIQSRRVSEGKRELQVGFKQPQTYKLT… |
| A0A210QF32 | 1-141 | MAVNLTEVDPSDEEECKLAEAALACYESGCLTPLIKEELKYKIHTRRMEQGKGELQVQFTAPDRSELTAEEVLKSDRRRQQNRQAAR… |
| A0A8B6C5S1 | 2-133 | None |
| V4A9W5 | 1-165 | None |
| V3ZFW6 | 10-172 | None |
| A0A3S1A058 | 410-575 | None |
| A0A3B4EML3 | 2-166 | None |
| A0A0B7B045 | 87-280 | None |
| A0A210QW97 | 1-151 | None |
| A0A0B6ZPG0 | 24-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.