DPCstruct | MC20050
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 179 ± 29 aa |
| Standard deviation of domain lengths | 29.15 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.64 |
| Pfam Score | 98.21 |
| Assigned Pfam label(s) | CL0063- CL0044- CL0335- CL0551 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A7S109 | 2-137 | VKDFIGYKLRQNNIFLEGFNMESPTKASKHLRIVADELIADNSELFHSMCDQLHLTPISTYPTFVGIANEIFQSGKNWGRVVAFLAF… |
| A0A210QQK5 | 12-177 | KREMNPTASRYLVVDYINYRLTKQGITWANCPPLLSQPTEIHTTLRKMGDEFEERYAVQFSDLGSQLNMSQYNAYPTFNTAVGELFH… |
| A0A498NNV2 | 118-273 | None |
| A0A813W1N3 | 4-200 | None |
| A0A6S7I151 | 12-194 | None |
| A0A0R3T181 | 15-223 | None |
| A0A3Q1GS47 | 113-350 | None |
| T1FK63 | 199-375 | None |
| H0ZU95 | 6-166 | None |
| H0ZZC9 | 13-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.