DPCstruct | MC2005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 110 ± 9 aa |
| Standard deviation of domain lengths | 9.45 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1N7PA67 | 8-109 | LWAVLLPSFALADTRPVNCEITVGGVRHVTGRCYFSPRSGGSFQVGNDSYFADVSVNTPGQADGHWNADPLSTHAQAPLGALRQEGA… |
| A0A2E7UIV4 | 136-227 | SSPPPSVPQGTCRIRAEGQVVLDGTCLINLQQGGSFWVLSPDLRVFAEVDRFGAAADSYVSSEDLSFASNGEFGEVTRSGACWSNDS… |
| A0A7X6FRY6 | 131-233 | None |
| A0A1H7S8R4 | 51-173 | None |
| A0A850Q823 | 246-354 | None |
| A0A6M1LPU8 | 6-120 | None |
| A0A4Q3Y4Q2 | 107-220 | None |
| A0A3D5I026 | 2-99 | None |
| A0A7R6WVD8 | 3-137 | None |
| A0A7I0RCU4 | 63-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.