DPCstruct | MC20045
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 159 ± 9 aa |
| Standard deviation of domain lengths | 9.38 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7QUK9 | 1-167 | MDIETAMLGIRALQSDVRRKPPPPEEGGTSVGDNIINFALVRGTRPYLERIAHQINGSYDNGWYDAAAVMIRRLVETLIIEVYEANG… |
| A0A532TF94 | 5-167 | EEQKKSDFKLKYEIIIDLDIAIKEVYREIVGDINNAYGKGLFDCVYILVRKLLENLIIDCLRKYYTMQNSIKFYNRNKERFHSFSQL… |
| A0A7T9D0Y4 | 83-233 | None |
| A0A4P8WHL0 | 92-236 | None |
| A0A7J4HZL2 | 152-305 | None |
| A0A0F9NER6 | 160-317 | None |
| A0A0F9UA69 | 138-298 | None |
| A0A0F8C2C8 | 238-389 | None |
| A0A523RUS1 | 83-263 | None |
| A0A3R7DX65 | 115-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.