DPCstruct | MC20044
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 67 ± 10 aa |
| Standard deviation of domain lengths | 9.88 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 37.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0045 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z1IHX9 | 109-171 | AQPAPQSAISLIHQQPVRWTHDRIVACDGGGGPLGHPRIFINTDKPEICNCTYCGLPFANEHH |
| A0A318PW34 | 1-69 | MQDLTKHQPNPTPHPVLGLIETIVVDSRVLSCDGGLGALGHPRVFLRIADHQTFCPYCSRLFVLNPEAT |
| A0A840I120 | 27-77 | None |
| A0A2E3XDF1 | 3-49 | None |
| M2SA23 | 27-89 | None |
| A0A537ULI7 | 2-59 | None |
| A0A4Y9EJN5 | 2-60 | None |
| A0A2S5B5L1 | 1-65 | None |
| A0A2E1YTC6 | 2-52 | None |
| A0A7C5R015 | 2-45 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.