DPCstruct | MC20043
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 73 ± 6 aa |
| Standard deviation of domain lengths | 6.00 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 50.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M4FD20 | 17-87 | THDDVLNSLRIPPQLMGTVPQNAGGFGSVREAAQIYATHELEPIQACMAQVNHWLEEEVLRFKHYEIPVWA |
| A0A6D0EHA2 | 135-204 | NVSRDDMMAAHRVPPQMMGIIPNNTGGFGDVEKASRVFVRNELLPLQKRCEELNEWLNEEVIKFRPYLLD |
| A0A5E7HVG7 | 97-169 | None |
| D4B831 | 44-132 | None |
| A0A837FXK7 | 45-116 | None |
| A0A7I7ACB7 | 225-290 | None |
| A0A7W5NTK0 | 16-86 | None |
| A0A081J362 | 3-73 | None |
| A0A736RC77 | 18-85 | None |
| A0A1I6KST6 | 99-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.