DPCstruct | MC20042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 102 ± 7 aa |
| Standard deviation of domain lengths | 7.03 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S2TQ36 | 109-206 | ANFMFAVSAKRYQESGPASFTEAMHVLNSGGRLEYAFRRLGVWDEVEGVPPEQLAQGRMGVYESNGHAALVFKGREERWGKRGGPSP… |
| A0A3M4F4N4 | 1-87 | MENNDGSASASFLQATVTLNDGEYGRESLERLGLKNHYRVSSSSELANGALGVVDFGGHSMAVVGGRLELWGNRGGRPQEGNAYALI |
| A0A2V5AXD0 | 238-332 | None |
| A0A379JBR7 | 59-174 | None |
| A0A7W7JAF8 | 229-329 | None |
| A0A2G0W456 | 99-202 | None |
| A0A2N5F9Y9 | 1-105 | None |
| A0A7Y8B9N6 | 185-285 | None |
| A0A7Y0W208 | 566-668 | None |
| A0A7Y8EIP0 | 427-532 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.