DPCstruct | MC20041
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 892 ± 102 aa |
| Standard deviation of domain lengths | 101.59 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 13.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5QW37 | 180-1134 | DWFKTESENFTILYRESHSSLIPYIIRSAEGSLKILMDLFEYEPSEKIIINTYDVSDYGFGATTTIPQNYIRIEIEPLEPGYENIPY… |
| A0A1F7F9Z4 | 6-1009 | VIAFTLFLALQAFSYPEYLQDYNQPYKKWFKAETEHFTVYYLSGLKEQAEYAAAVGEEAYTGLTEYYGLQLPGKIDFIIDDDDFSNG… |
| A0A2T2V5B1 | 44-943 | None |
| A0A2V7XAI0 | 279-1249 | None |
| A0A833N667 | 1-1012 | None |
| A0A7Y5G8R7 | 4-793 | None |
| A0A1W9RKX3 | 14-1087 | None |
| A0A7C4Y9T4 | 8-854 | None |
| A0A7C1BBD1 | 2-848 | None |
| A0A7X7S109 | 3-1044 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.