DPCstruct | MC20040
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 62 ± 2 aa |
| Standard deviation of domain lengths | 2.40 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 84.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 47.28 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | CL0431- CL0552 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0W631 | 11-72 | SEIDETMKKLTSHPGVIGFLVTNADGIPIRSSLDHAEAVQYAGLLTLLATKARAAVRELDSQ |
| W7FEZ0 | 17-76 | YSEAEEILNRIKNHKGVIGILVVNSEGLIIKSTFDQQQSDLHASLLTQLSKKARDVIREL |
| F0WUI3 | 1-65 | None |
| A0A7R9FUZ8 | 312-373 | None |
| A0A672G632 | 71-132 | None |
| A0A0D8Y8K0 | 89-154 | None |
| S9WLE3 | 373-434 | None |
| A0A812KNG8 | 96-150 | None |
| A0A6J2KJW8 | 1-61 | None |
| A0A7R8CUR7 | 248-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.