DPCstruct | MC20028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 363 ± 35 aa |
| Standard deviation of domain lengths | 34.86 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812M9X7 | 375-718 | SLLADLCLLPGQLFFHLVMDICLLRMRHVWKEMRFVAYFEANYLRKRRAPQGSGLEVMHDATWRFGMAGPLLRGHPPTQQTAEQANA… |
| A0A812QK73 | 1-379 | MEQKGRKKDKTETAFDRLDAIIQASRVMPTIILFDAVWHLTFAWLEQVSKDACAYLKSTYFDQMKRASLQGQFWCGEPVWNSNSCWF… |
| A0A812TX71 | 493-859 | None |
| A0A812YV68 | 323-689 | None |
| A0A812VWC3 | 765-1155 | None |
| A0A812K8W7 | 1-393 | None |
| A0A812NWR6 | 431-826 | None |
| A0A812NF85 | 843-1194 | None |
| A0A813AZR4 | 136-412 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.