DPCstruct | MC20026
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 113 ± 10 aa |
| Standard deviation of domain lengths | 9.68 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 68.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 38.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812P654 | 2-107 | KLRQLLKEHGSFGAVEVHVKKHHKTLLGKSKNGGWYTRQYLLNVAQWSKKMVDNAFTWAKSKGLLRVNPVHGEEEARLVLNESFEIV… |
| A0A812J7C1 | 136-243 | GEQLRELLKKHGNFKSLEMNLRKFHLKKKILAKRSSYVTKAYLLGHCHWPMVEKAWVWANEHKVLRKNEVHGEEEAKLILSEDFDLL… |
| A0A812KYS5 | 247-364 | None |
| A0A812KIH0 | 1-94 | None |
| A0A812N2J2 | 15-124 | None |
| A0A812MGD4 | 63-167 | None |
| A0A1Q9CM84 | 218-346 | None |
| A0A812YZ03 | 231-358 | None |
| A0A812MTQ2 | 30-141 | None |
| A0A812L6M4 | 155-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.