DPCstruct | MC20022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 381 ± 51 aa |
| Standard deviation of domain lengths | 51.39 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 15.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3I1I3 | 219-554 | DVPEEVREELQKKAEAMADRLREQIAQGEMPGMGGMHMRSPEDRMKRMEELAEKVKKFNVGKVGLKQQFVTDVRAMLQPDQLDRWPA… |
| A0A812MSE1 | 23-399 | PAPAGLQGPSRDLGSSPVTEPEFETYLDILQLDDATASVAKDMYEGFRTEVAELNANFRQEMSDLVAEIQKTGDHSAFIEKMGPLRK… |
| A0A4P5XK89 | 53-502 | None |
| A0A5C5VR97 | 1-348 | None |
| A0A1Z8Y3Q5 | 157-609 | None |
| A0A3L7TRP0 | 15-483 | None |
| A0A3D0MN41 | 193-550 | None |
| A0A3L7T1J6 | 81-317 | None |
| A0A2E7Y639 | 481-866 | None |
| A0A7Y3UB70 | 59-457 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.