DPCstruct | MC2002
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 151 ± 16 aa |
| Standard deviation of domain lengths | 15.94 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 45.61 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0111- CL0093 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X7ZXT9 | 1-174 | MVLGVTLTVTALIALHVLDSADGIRHRRFLPPRWWSITPLDVLVIAALVWWQFVGANTADDGYILTMARVSEHAGYMANYYRWFGTP… |
| A0A6G3VMJ7 | 1-126 | SRYTTAPTILKWLVLIVGIICTLLSLAALAVLDSTDGRKHRRILPARWWRLNARDYVVIGALILWHFIGPNTSDDGYLLTMARVAQN… |
| A0A1X1T491 | 2-141 | None |
| X8A0F3 | 191-356 | None |
| A0A8A6W681 | 175-326 | None |
| A0A553A3S5 | 177-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.