DPCstruct | MC20016
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 114 ± 9 aa |
| Standard deviation of domain lengths | 8.60 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7LNS8 | 7-123 | LEKWYDKEIEDWGGETSPEYRNFQTNYRSVIKDFCKDIGMELHSFSKNHYDFSAVVKSNKTNQFYYISISDVRCWKNEWANNILYRT… |
| V2XTT2 | 12-136 | KLADLLRRDLSYIWGEREGGPNGDKRVFLNTGKTFLRALTKDLGLVEYNVSANPGGIAVTGETTLIGMWGNSGIYIQIEQPCYDRER… |
| A0A3A9BI42 | 11-139 | None |
| A0A031JRG0 | 267-371 | None |
| A0A5C7J6R4 | 1-104 | None |
| A0A843GLN4 | 11-123 | None |
| A0A1Y4HAA6 | 1-123 | None |
| A0A1D9FHU3 | 2-123 | None |
| A0A4R1VQW4 | 80-199 | None |
| A0A1D9P5H2 | 198-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.