DPCstruct | MC20015
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 131 ± 11 aa |
| Standard deviation of domain lengths | 11.33 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A417GPN5 | 5-147 | VRPATKTEQMYCYTQSDQIMGQTGCIGHLRADMGDSGDQFFHDWTSHCERLLTPEFDDEFNQLINQLREDDGFLKSRAAVSAYCYRQ… |
| V2XTU1 | 12-138 | CPFPEVFQDTERVEGSFIDVPRRKIGHIRADHDNYRWWSTVWPCHSELVTPAITMEIDQVYDALTANDALADFETLVQFCHAHPEAR… |
| A0A1Q6KM35 | 13-141 | None |
| A0A1Y3RUU5 | 8-147 | None |
| V9HIN8 | 31-158 | None |
| A0A4R2MEG0 | 96-228 | None |
| A0A373B6C2 | 59-182 | None |
| A0A1Y4LGQ3 | 13-149 | None |
| A0A2N5ICE1 | 2-111 | None |
| A0A4R1QXV2 | 13-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.