DPCstruct | MC20012
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 379 ± 34 aa |
| Standard deviation of domain lengths | 33.54 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 17.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q4JXJ4 | 1-332 | MSRINALNVALVLAASVLGLLSITLNANPVPTQDNAISNSLALYYSLGPILGFIGAKEMARFRSFFKSRGSVQDVFKVWLRSLALPL… |
| A0A423UG39 | 2-377 | PALFAGIASSVLCRQFDAANVLVGGVASRGSSRIWAYHLRRVVSLVLLGYVLGLIPLFIRLTATATWGSPDILALLDGCAVMCFLAT… |
| A0A7W0A5A9 | 1-435 | None |
| A0A1G9XA81 | 4-379 | None |
| A0A433FAT6 | 26-445 | None |
| A0A7M1R1G0 | 17-423 | None |
| A0A4R9AMN2 | 68-479 | None |
| A0A4Y3MZY4 | 6-389 | None |
| A0A7X0P449 | 19-388 | None |
| A0A438MPT0 | 19-388 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.