DPCstruct | MC2001
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 88 ± 13 aa |
| Standard deviation of domain lengths | 12.66 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 94.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 39.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0046 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J9XQZ5 | 279-353 | IRKLSNRLYQKTGLTPNDVQVIELHDCFAPNELISYEALGLCPIGKGGDIVDKGDNTYGGKWVINPSGGLISKGH |
| A0A2D6T869 | 146-226 | LPEPLEIPGAAAAARQAYQRAGIGPGDVDFAEIYDCFTISALLQIEDLGFCGKGEAAAFIRERGITIDGGLPVNTHGGLLS |
| A0A2E1Y0N4 | 310-388 | None |
| A0A6G3VUW6 | 1-110 | None |
| A0A7W1QDE6 | 5-87 | None |
| A0A813QBL0 | 247-347 | None |
| A0A2A2K1N2 | 277-379 | None |
| A0A2S8BJC1 | 589-686 | None |
| L5K376 | 531-605 | None |
| F8F1C3 | 178-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.