DPCstruct | MC20008
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 251 ± 29 aa |
| Standard deviation of domain lengths | 29.42 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C0VE00 | 41-308 | IFQIILQIYGWEEGWNLLVRMGANARIFDQSGNVRDAVINREIAVGTTIDFYGYTAQWLNPEFCRYVFPADGTIVNADPIALLTTSQ… |
| A0A1V5M7L1 | 21-278 | AEGWRTALNLLKRIGANCRYFTDSASKVPLDVAQGNAAAGMCIDFYGRFQSETVEREEGSKRMRYFTPTGGSSFSADPVGILRGAPD… |
| A0A7J2LBD8 | 28-267 | None |
| A0A7T9EHF3 | 313-608 | None |
| A0A2R7PSV4 | 10-249 | None |
| A0A3S4LN77 | 3-215 | None |
| A0A662I617 | 1-215 | None |
| A0A662G653 | 3-228 | None |
| A0A3C1AXZ4 | 202-460 | None |
| A0A5J4E2G9 | 1-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.