DPCstruct | MC20002
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 152 ± 11 aa |
| Standard deviation of domain lengths | 10.81 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 25.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14902 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8ACU3 | 1-148 | MMHNWMECKVRYEKTLDNGVEKCVTEPYLMDALSFTEAEARMNEYIKPFISGEFSVTAIKIQNYEEVFGLENADQGDKWYHCRLAYL… |
| A0A4R5FLP0 | 99-234 | NSASVYCVTILQGTKKRNYYLYANSVDLALNIITDFLEQKIEGSFSFTSVKEMGFSNLIPLEDDDLDKDFYKIEVEIAYEEDDPFKQ… |
| A0A4Q2UN44 | 1-155 | None |
| A0A7W7N632 | 54-210 | None |
| A0A286IIE1 | 1-162 | None |
| A0A3A5SG85 | 2-158 | None |
| I0KAR9 | 2-150 | None |
| A0A6P1VTA1 | 1-139 | None |
| S0GJF9 | 38-198 | None |
| I0KCG3 | 1-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.