DPCstruct | MC20001
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 84 ± 21 aa |
| Standard deviation of domain lengths | 21.25 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 77.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 56.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L6FMT4 | 12-85 | ENMTWRIWNLARKKEIDPRHRYGHNLHLYYDIWCTNSSCEPFFYWLDVGKGRDLHHQKCPRSKLNSQLIMYLGP |
| A0A7N2MTF1 | 2-62 | EKIDPRHHYGHNLHFYYDVCSDSKSTQPFFYWLDVGDGKDLNLERCLRTVLQRQCIAYLGP |
| A0A7N0TJD5 | 219-286 | None |
| A0A3N7G2J1 | 4-86 | None |
| A0A3N7G2G1 | 82-175 | None |
| A0A0V0QTE5 | 484-549 | None |
| A0A5A7SX12 | 19-111 | None |
| A0A287PNV8 | 198-269 | None |
| A0A251SFY6 | 97-183 | None |
| A0A4Y1QTF2 | 525-592 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.